Anti RHBDL3 pAb (ATL-HPA059607)

Atlas Antibodies

Catalog No.:
ATL-HPA059607-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: rhomboid, veinlet-like 3 (Drosophila)
Gene Name: RHBDL3
Alternative Gene Name: RHBDL4, VRHO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017692: 92%, ENSRNOG00000005515: 92%
Entrez Gene ID: 162494
Uniprot ID: P58872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFDPGNTGYISTGKFRSLLESHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNS
Gene Sequence QFDPGNTGYISTGKFRSLLESHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNS
Gene ID - Mouse ENSMUSG00000017692
Gene ID - Rat ENSRNOG00000005515
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHBDL3 pAb (ATL-HPA059607)
Datasheet Anti RHBDL3 pAb (ATL-HPA059607) Datasheet (External Link)
Vendor Page Anti RHBDL3 pAb (ATL-HPA059607) at Atlas Antibodies

Documents & Links for Anti RHBDL3 pAb (ATL-HPA059607)
Datasheet Anti RHBDL3 pAb (ATL-HPA059607) Datasheet (External Link)
Vendor Page Anti RHBDL3 pAb (ATL-HPA059607)