Anti RHBDL2 pAb (ATL-HPA043807)

Atlas Antibodies

Catalog No.:
ATL-HPA043807-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: rhomboid, veinlet-like 2 (Drosophila)
Gene Name: RHBDL2
Alternative Gene Name: FLJ20435
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043333: 92%, ENSRNOG00000018097: 32%
Entrez Gene ID: 54933
Uniprot ID: Q9NX52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YAVWKPQKQWITLDTGILESPFIYSPEKREEAWRFISY
Gene Sequence YAVWKPQKQWITLDTGILESPFIYSPEKREEAWRFISY
Gene ID - Mouse ENSMUSG00000043333
Gene ID - Rat ENSRNOG00000018097
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHBDL2 pAb (ATL-HPA043807)
Datasheet Anti RHBDL2 pAb (ATL-HPA043807) Datasheet (External Link)
Vendor Page Anti RHBDL2 pAb (ATL-HPA043807) at Atlas Antibodies

Documents & Links for Anti RHBDL2 pAb (ATL-HPA043807)
Datasheet Anti RHBDL2 pAb (ATL-HPA043807) Datasheet (External Link)
Vendor Page Anti RHBDL2 pAb (ATL-HPA043807)