Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045074-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: rhomboid domain containing 2
Gene Name: RHBDD2
Alternative Gene Name: NPD007, RHBDL7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039917: 84%, ENSRNOG00000001443: 79%
Entrez Gene ID: 57414
Uniprot ID: Q6NTF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP
Gene Sequence HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP
Gene ID - Mouse ENSMUSG00000039917
Gene ID - Rat ENSRNOG00000001443
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation)
Datasheet Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation)
Datasheet Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation)