Anti RGS14 pAb (ATL-HPA046847 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046847-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: regulator of G-protein signaling 14
Gene Name: RGS14
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052087: 96%, ENSRNOG00000015616: 94%
Entrez Gene ID: 10636
Uniprot ID: O43566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKP
Gene Sequence LTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKP
Gene ID - Mouse ENSMUSG00000052087
Gene ID - Rat ENSRNOG00000015616
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RGS14 pAb (ATL-HPA046847 w/enhanced validation)
Datasheet Anti RGS14 pAb (ATL-HPA046847 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGS14 pAb (ATL-HPA046847 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RGS14 pAb (ATL-HPA046847 w/enhanced validation)
Datasheet Anti RGS14 pAb (ATL-HPA046847 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGS14 pAb (ATL-HPA046847 w/enhanced validation)