Anti RGS11 pAb (ATL-HPA043039)

Atlas Antibodies

Catalog No.:
ATL-HPA043039-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: regulator of G-protein signaling 11
Gene Name: RGS11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024186: 72%, ENSRNOG00000003800: 38%
Entrez Gene ID: 8786
Uniprot ID: O94810
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPL
Gene Sequence GDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPL
Gene ID - Mouse ENSMUSG00000024186
Gene ID - Rat ENSRNOG00000003800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RGS11 pAb (ATL-HPA043039)
Datasheet Anti RGS11 pAb (ATL-HPA043039) Datasheet (External Link)
Vendor Page Anti RGS11 pAb (ATL-HPA043039) at Atlas Antibodies

Documents & Links for Anti RGS11 pAb (ATL-HPA043039)
Datasheet Anti RGS11 pAb (ATL-HPA043039) Datasheet (External Link)
Vendor Page Anti RGS11 pAb (ATL-HPA043039)