Anti RGP1 pAb (ATL-HPA021085)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021085-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RGP1
Alternative Gene Name: KIAA0258
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028468: 95%, ENSRNOG00000016309: 95%
Entrez Gene ID: 9827
Uniprot ID: Q92546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDS |
| Gene Sequence | SKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDS |
| Gene ID - Mouse | ENSMUSG00000028468 |
| Gene ID - Rat | ENSRNOG00000016309 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RGP1 pAb (ATL-HPA021085) | |
| Datasheet | Anti RGP1 pAb (ATL-HPA021085) Datasheet (External Link) |
| Vendor Page | Anti RGP1 pAb (ATL-HPA021085) at Atlas Antibodies |
| Documents & Links for Anti RGP1 pAb (ATL-HPA021085) | |
| Datasheet | Anti RGP1 pAb (ATL-HPA021085) Datasheet (External Link) |
| Vendor Page | Anti RGP1 pAb (ATL-HPA021085) |