Anti RGP1 pAb (ATL-HPA020414)

Atlas Antibodies

Catalog No.:
ATL-HPA020414-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RGP1 retrograde golgi transport homolog (S. cerevisiae)
Gene Name: RGP1
Alternative Gene Name: KIAA0258
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028468: 100%, ENSRNOG00000016309: 100%
Entrez Gene ID: 9827
Uniprot ID: Q92546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPP
Gene Sequence MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPP
Gene ID - Mouse ENSMUSG00000028468
Gene ID - Rat ENSRNOG00000016309
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RGP1 pAb (ATL-HPA020414)
Datasheet Anti RGP1 pAb (ATL-HPA020414) Datasheet (External Link)
Vendor Page Anti RGP1 pAb (ATL-HPA020414) at Atlas Antibodies

Documents & Links for Anti RGP1 pAb (ATL-HPA020414)
Datasheet Anti RGP1 pAb (ATL-HPA020414) Datasheet (External Link)
Vendor Page Anti RGP1 pAb (ATL-HPA020414)