Anti RFPL4A pAb (ATL-HPA046368)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046368-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RFPL4A
Alternative Gene Name: RFPL4, RNF210
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035191: 56%, ENSRNOG00000015743: 53%
Entrez Gene ID: 342931
Uniprot ID: A6NLU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIK |
| Gene Sequence | PDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIK |
| Gene ID - Mouse | ENSMUSG00000035191 |
| Gene ID - Rat | ENSRNOG00000015743 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RFPL4A pAb (ATL-HPA046368) | |
| Datasheet | Anti RFPL4A pAb (ATL-HPA046368) Datasheet (External Link) |
| Vendor Page | Anti RFPL4A pAb (ATL-HPA046368) at Atlas Antibodies |
| Documents & Links for Anti RFPL4A pAb (ATL-HPA046368) | |
| Datasheet | Anti RFPL4A pAb (ATL-HPA046368) Datasheet (External Link) |
| Vendor Page | Anti RFPL4A pAb (ATL-HPA046368) |