Anti RET pAb (ATL-HPA008356)

Atlas Antibodies

Catalog No.: ATL-HPA008356-25

Protein Description: ret proto-oncogene
Gene Name: RET
Alternative Gene Name: CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030110: 91%, ENSRNOG00000014751: 93%
Entrez Gene ID: 5979
Uniprot ID: P07949
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
• Gene Sequence: NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
• Gene ID - Mouse: ENSMUSG00000030110
• Gene ID - Rat: ENSRNOG00000014751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RET pAb (ATL-HPA008356) – 4 Found

Buchholz, Karolina; Antosik, Paulina; Grzanka, Dariusz; Gagat, Maciej; Smolińska, Marta; Grzanka, Alina; Gzil, Arkadiusz; Kasperska, Anna; Klimaszewska-Wiśniewska, Anna. Expression of the Body-Weight Signaling Players: GDF15, GFRAL and RET and their clinical relevance in Gastric Cancer. Journal Of Cancer. 12(15):4698-4709. 

Luo, Y; Tsuchiya, K D; Il Park, D; Fausel, R; Kanngurn, S; Welcsh, P; Dzieciatkowski, S; Wang, J; Grady, W M. RET is a potential tumor suppressor gene in colorectal cancer. Oncogene. 2013;32(16):2037-47. 

Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. 

Garcia-Rendueles, Angela R; Chenlo, Miguel; Oroz-Gonjar, Fernando; Solomou, Antonia; Mistry, Anisha; Barry, Sayka; Gaston-Massuet, Carles; Garcia-Lavandeira, Montserrat; Perez-Romero, Sihara; Suarez-Fariña, Maria; Pradilla-Dieste, Alberto; Dieguez, Carlos; Mehlen, Patrick; Korbonits, Márta; Alvarez, Clara V. RET signalling provides tumorigenic mechanism and tissue specificity for AIP-related somatotrophinomas. Oncogene. 2021;40(45):6354-6368.