Anti RESP18 pAb (ATL-HPA045849)

Atlas Antibodies

Catalog No.:
ATL-HPA045849-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: regulated endocrine-specific protein 18
Gene Name: RESP18
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022016: 26%, ENSRNOG00000005133: 28%
Entrez Gene ID: 389075
Uniprot ID: Q5W5W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWATS
Gene Sequence PTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWATS
Gene ID - Mouse ENSMUSG00000022016
Gene ID - Rat ENSRNOG00000005133
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RESP18 pAb (ATL-HPA045849)
Datasheet Anti RESP18 pAb (ATL-HPA045849) Datasheet (External Link)
Vendor Page Anti RESP18 pAb (ATL-HPA045849) at Atlas Antibodies

Documents & Links for Anti RESP18 pAb (ATL-HPA045849)
Datasheet Anti RESP18 pAb (ATL-HPA045849) Datasheet (External Link)
Vendor Page Anti RESP18 pAb (ATL-HPA045849)