Anti REG1A pAb (ATL-HPA045579)

Atlas Antibodies

Catalog No.:
ATL-HPA045579-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: regenerating islet-derived 1 alpha
Gene Name: REG1A
Alternative Gene Name: PSP, PSPS, PSPS1, PTP, REG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059654: 79%, ENSRNOG00000006486: 76%
Entrez Gene ID: 5967
Uniprot ID: P05451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWG
Gene Sequence TDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWG
Gene ID - Mouse ENSMUSG00000059654
Gene ID - Rat ENSRNOG00000006486
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti REG1A pAb (ATL-HPA045579)
Datasheet Anti REG1A pAb (ATL-HPA045579) Datasheet (External Link)
Vendor Page Anti REG1A pAb (ATL-HPA045579) at Atlas Antibodies

Documents & Links for Anti REG1A pAb (ATL-HPA045579)
Datasheet Anti REG1A pAb (ATL-HPA045579) Datasheet (External Link)
Vendor Page Anti REG1A pAb (ATL-HPA045579)