Anti REG1A pAb (ATL-HPA045579)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045579-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: REG1A
Alternative Gene Name: PSP, PSPS, PSPS1, PTP, REG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059654: 79%, ENSRNOG00000006486: 76%
Entrez Gene ID: 5967
Uniprot ID: P05451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWG |
Gene Sequence | TDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWG |
Gene ID - Mouse | ENSMUSG00000059654 |
Gene ID - Rat | ENSRNOG00000006486 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti REG1A pAb (ATL-HPA045579) | |
Datasheet | Anti REG1A pAb (ATL-HPA045579) Datasheet (External Link) |
Vendor Page | Anti REG1A pAb (ATL-HPA045579) at Atlas Antibodies |
Documents & Links for Anti REG1A pAb (ATL-HPA045579) | |
Datasheet | Anti REG1A pAb (ATL-HPA045579) Datasheet (External Link) |
Vendor Page | Anti REG1A pAb (ATL-HPA045579) |