Anti REG1A pAb (ATL-HPA045549 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045549-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: REG1A
Alternative Gene Name: PSP, PSPS, PSPS1, PTP, REG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059654: 82%, ENSRNOG00000006486: 74%
Entrez Gene ID: 5967
Uniprot ID: P05451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV |
| Gene Sequence | PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV |
| Gene ID - Mouse | ENSMUSG00000059654 |
| Gene ID - Rat | ENSRNOG00000006486 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti REG1A pAb (ATL-HPA045549 w/enhanced validation) | |
| Datasheet | Anti REG1A pAb (ATL-HPA045549 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti REG1A pAb (ATL-HPA045549 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti REG1A pAb (ATL-HPA045549 w/enhanced validation) | |
| Datasheet | Anti REG1A pAb (ATL-HPA045549 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti REG1A pAb (ATL-HPA045549 w/enhanced validation) |