Anti REG1A pAb (ATL-HPA045549 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045549-25

• 
• 

Protein Description: regenerating islet-derived 1 alpha
Gene Name: REG1A
Alternative Gene Name: PSP, PSPS, PSPS1, PTP, REG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059654: 82%, ENSRNOG00000006486: 74%
Entrez Gene ID: 5967
Uniprot ID: P05451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV
• Gene Sequence: PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV
• Gene ID - Mouse: ENSMUSG00000059654
• Gene ID - Rat: ENSRNOG00000006486
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.