Anti REEP6 pAb (ATL-HPA048015 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA048015-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: receptor accessory protein 6
Gene Name: REEP6
Alternative Gene Name: C19orf32, DP1L1, FLJ25383
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035504: 79%, ENSRNOG00000033262: 79%
Entrez Gene ID: 92840
Uniprot ID: Q96HR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVT
Gene Sequence MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVT
Gene ID - Mouse ENSMUSG00000035504
Gene ID - Rat ENSRNOG00000033262
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti REEP6 pAb (ATL-HPA048015 w/enhanced validation)
Datasheet Anti REEP6 pAb (ATL-HPA048015 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti REEP6 pAb (ATL-HPA048015 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti REEP6 pAb (ATL-HPA048015 w/enhanced validation)
Datasheet Anti REEP6 pAb (ATL-HPA048015 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti REEP6 pAb (ATL-HPA048015 w/enhanced validation)