Anti RECQL5 pAb (ATL-HPA029971 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029971-25

Protein Description: RecQ protein-like 5
Gene Name: RECQL5
Alternative Gene Name: FLJ90603, RecQ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020752: 73%, ENSRNOG00000005107: 72%
Entrez Gene ID: 9400
Uniprot ID: O94762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELEHETFRNAKVANLYKASVLKKVADIHRASKDGQPYDMGGSAKSCSAQAEPPEPNEYDIPPASHVYSLKPKRVGAGFPKGSCPFQTATELMETTRIREQ
• Gene Sequence: ELEHETFRNAKVANLYKASVLKKVADIHRASKDGQPYDMGGSAKSCSAQAEPPEPNEYDIPPASHVYSLKPKRVGAGFPKGSCPFQTATELMETTRIREQ
• Gene ID - Mouse: ENSMUSG00000020752
• Gene ID - Rat: ENSRNOG00000005107
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RECQL5 pAb (ATL-HPA029971 w/enhanced validation) – 6 Found

Patterson, Karl; Arya, Lovleen; Bottomley, Sarah; Morgan, Susan; Cox, Angela; Catto, James; Bryant, Helen E. Altered RECQL5 expression in urothelial bladder carcinoma increases cellular proliferation and makes RECQL5 helicase activity a novel target for chemotherapy. Oncotarget. 2016;7(46):76140-76150. 

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Lao, Victoria Valinluck; Welcsh, Piri; Luo, Yanxin; Carter, Kelly T; Dzieciatkowski, Slavomir; Dintzis, Suzanne; Meza, Jane; Sarvetnick, Nora E; Monnat, Raymond J Jr; Loeb, Lawrence A; Grady, William M. Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers. Translational Oncology. 2013;6(4):458-69. 

Arora, Arvind; Abdel-Fatah, Tarek M A; Agarwal, Devika; Doherty, Rachel; Croteau, Deborah L; Moseley, Paul M; Hameed, Khalid; Green, Andrew; Aleskandarany, Mohammed A; Rakha, Emad A; Patterson, Karl; Ball, Graham; Chan, Stephen Y T; Ellis, Ian O; Bohr, Vilhelm A; Bryant, Helen E; Madhusudan, Srinivasan. Clinicopathological and prognostic significance of RECQL5 helicase expression in breast cancers. Carcinogenesis. 2016;37(1):63-71. 

Lin, Yijia; Wang, Huashe; Wang, Xinyou; Li, Miao; Chen, Honglei; Peng, Junsheng. Low expression of RecQ-like helicase 5 is associated with poor prognosis in patients with gastric cancer. Oncology Letters. 2020;19(1):985-991.