Anti RCOR1 pAb (ATL-HPA049327)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049327-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RCOR1
Alternative Gene Name: COREST, KIAA0071, RCOR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037896: 86%, ENSRNOG00000008067: 80%
Entrez Gene ID: 23186
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS |
| Gene Sequence | QEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS |
| Gene ID - Mouse | ENSMUSG00000037896 |
| Gene ID - Rat | ENSRNOG00000008067 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RCOR1 pAb (ATL-HPA049327) | |
| Datasheet | Anti RCOR1 pAb (ATL-HPA049327) Datasheet (External Link) |
| Vendor Page | Anti RCOR1 pAb (ATL-HPA049327) at Atlas Antibodies |
| Documents & Links for Anti RCOR1 pAb (ATL-HPA049327) | |
| Datasheet | Anti RCOR1 pAb (ATL-HPA049327) Datasheet (External Link) |
| Vendor Page | Anti RCOR1 pAb (ATL-HPA049327) |