Anti RCN3 pAb (ATL-HPA043134)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043134-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RCN3
Alternative Gene Name: RLP49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019539: 97%, ENSRNOG00000043007: 97%
Entrez Gene ID: 57333
Uniprot ID: Q96D15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYK |
| Gene Sequence | DGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYK |
| Gene ID - Mouse | ENSMUSG00000019539 |
| Gene ID - Rat | ENSRNOG00000043007 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RCN3 pAb (ATL-HPA043134) | |
| Datasheet | Anti RCN3 pAb (ATL-HPA043134) Datasheet (External Link) |
| Vendor Page | Anti RCN3 pAb (ATL-HPA043134) at Atlas Antibodies |
| Documents & Links for Anti RCN3 pAb (ATL-HPA043134) | |
| Datasheet | Anti RCN3 pAb (ATL-HPA043134) Datasheet (External Link) |
| Vendor Page | Anti RCN3 pAb (ATL-HPA043134) |
| Citations for Anti RCN3 pAb (ATL-HPA043134) – 1 Found |
| Yang, Jingwei; Zhou, Xin; Dong, Ji; Wang, Wendong; Lu, Yongqu; Gao, Yuan; Zhang, Yu; Mao, Yunuo; Gao, Junpeng; Wang, Wei; Li, Qingqing; Gao, Shuai; Wen, Lu; Fu, Wei; Tang, Fuchou. Single-cell profiling reveals molecular basis of malignant phenotypes and tumor microenvironments in small bowel adenocarcinomas. Cell Discovery. 2022;8(1):92. PubMed |