Anti RCN3 pAb (ATL-HPA043134)

Atlas Antibodies

Catalog No.:
ATL-HPA043134-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: reticulocalbin 3, EF-hand calcium binding domain
Gene Name: RCN3
Alternative Gene Name: RLP49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019539: 97%, ENSRNOG00000043007: 97%
Entrez Gene ID: 57333
Uniprot ID: Q96D15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYK
Gene Sequence DGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYK
Gene ID - Mouse ENSMUSG00000019539
Gene ID - Rat ENSRNOG00000043007
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RCN3 pAb (ATL-HPA043134)
Datasheet Anti RCN3 pAb (ATL-HPA043134) Datasheet (External Link)
Vendor Page Anti RCN3 pAb (ATL-HPA043134) at Atlas Antibodies

Documents & Links for Anti RCN3 pAb (ATL-HPA043134)
Datasheet Anti RCN3 pAb (ATL-HPA043134) Datasheet (External Link)
Vendor Page Anti RCN3 pAb (ATL-HPA043134)
Citations for Anti RCN3 pAb (ATL-HPA043134) – 1 Found
Yang, Jingwei; Zhou, Xin; Dong, Ji; Wang, Wendong; Lu, Yongqu; Gao, Yuan; Zhang, Yu; Mao, Yunuo; Gao, Junpeng; Wang, Wei; Li, Qingqing; Gao, Shuai; Wen, Lu; Fu, Wei; Tang, Fuchou. Single-cell profiling reveals molecular basis of malignant phenotypes and tumor microenvironments in small bowel adenocarcinomas. Cell Discovery. 2022;8(1):92.  PubMed