Anti RCCD1 pAb (ATL-HPA040776 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040776-25

Protein Description: RCC1 domain containing 1
Gene Name: RCCD1
Alternative Gene Name: MGC14386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038930: 84%, ENSRNOG00000042059: 85%
Entrez Gene ID: 91433
Uniprot ID: A6NED2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFIAVQPFPALLDLPMGSDAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFVDKQLQVKAVTCGPWNTYVYAVEKG
• Gene Sequence: PFIAVQPFPALLDLPMGSDAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFVDKQLQVKAVTCGPWNTYVYAVEKG
• Gene ID - Mouse: ENSMUSG00000038930
• Gene ID - Rat: ENSRNOG00000042059
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.