Anti RBSN pAb (ATL-HPA044878)

Atlas Antibodies

Catalog No.: ATL-HPA044878-25

Protein Description: rabenosyn, RAB effector
Gene Name: RBSN
Alternative Gene Name: ZFYVE20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014550: 76%, ENSRNOG00000011391: 80%
Entrez Gene ID: 64145
Uniprot ID: Q9H1K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEIDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQC
• Gene Sequence: DSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEIDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQC
• Gene ID - Mouse: ENSMUSG00000014550
• Gene ID - Rat: ENSRNOG00000011391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBSN pAb (ATL-HPA044878) – 1 Found

Hsu, FoSheng; Spannl, Stephanie; Ferguson, Charles; Hyman, Anthony A; Parton, Robert G; Zerial, Marino. Rab5 and Alsin regulate stress-activated cytoprotective signaling on mitochondria. Elife. 2018;7( 29469808)