Anti RBSN pAb (ATL-HPA044878)

Atlas Antibodies

Catalog No.:
ATL-HPA044878-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: rabenosyn, RAB effector
Gene Name: RBSN
Alternative Gene Name: ZFYVE20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014550: 76%, ENSRNOG00000011391: 80%
Entrez Gene ID: 64145
Uniprot ID: Q9H1K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEIDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQC
Gene Sequence DSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEIDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQC
Gene ID - Mouse ENSMUSG00000014550
Gene ID - Rat ENSRNOG00000011391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBSN pAb (ATL-HPA044878)
Datasheet Anti RBSN pAb (ATL-HPA044878) Datasheet (External Link)
Vendor Page Anti RBSN pAb (ATL-HPA044878) at Atlas Antibodies

Documents & Links for Anti RBSN pAb (ATL-HPA044878)
Datasheet Anti RBSN pAb (ATL-HPA044878) Datasheet (External Link)
Vendor Page Anti RBSN pAb (ATL-HPA044878)
Citations for Anti RBSN pAb (ATL-HPA044878) – 1 Found
Hsu, FoSheng; Spannl, Stephanie; Ferguson, Charles; Hyman, Anthony A; Parton, Robert G; Zerial, Marino. Rab5 and Alsin regulate stress-activated cytoprotective signaling on mitochondria. Elife. 2018;7( 29469808)  PubMed