Anti RBSN pAb (ATL-HPA044878)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044878-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RBSN
Alternative Gene Name: ZFYVE20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014550: 76%, ENSRNOG00000011391: 80%
Entrez Gene ID: 64145
Uniprot ID: Q9H1K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEIDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQC |
Gene Sequence | DSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEIDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQC |
Gene ID - Mouse | ENSMUSG00000014550 |
Gene ID - Rat | ENSRNOG00000011391 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RBSN pAb (ATL-HPA044878) | |
Datasheet | Anti RBSN pAb (ATL-HPA044878) Datasheet (External Link) |
Vendor Page | Anti RBSN pAb (ATL-HPA044878) at Atlas Antibodies |
Documents & Links for Anti RBSN pAb (ATL-HPA044878) | |
Datasheet | Anti RBSN pAb (ATL-HPA044878) Datasheet (External Link) |
Vendor Page | Anti RBSN pAb (ATL-HPA044878) |
Citations for Anti RBSN pAb (ATL-HPA044878) – 1 Found |
Hsu, FoSheng; Spannl, Stephanie; Ferguson, Charles; Hyman, Anthony A; Parton, Robert G; Zerial, Marino. Rab5 and Alsin regulate stress-activated cytoprotective signaling on mitochondria. Elife. 2018;7( 29469808) PubMed |