Anti RBP3 pAb (ATL-HPA041301)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041301-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RBP3
Alternative Gene Name: D10S64, D10S65, D10S66, RP66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041534: 90%, ENSRNOG00000051911: 92%
Entrez Gene ID: 5949
Uniprot ID: P10745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDR |
| Gene Sequence | GVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDR |
| Gene ID - Mouse | ENSMUSG00000041534 |
| Gene ID - Rat | ENSRNOG00000051911 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RBP3 pAb (ATL-HPA041301) | |
| Datasheet | Anti RBP3 pAb (ATL-HPA041301) Datasheet (External Link) |
| Vendor Page | Anti RBP3 pAb (ATL-HPA041301) at Atlas Antibodies |
| Documents & Links for Anti RBP3 pAb (ATL-HPA041301) | |
| Datasheet | Anti RBP3 pAb (ATL-HPA041301) Datasheet (External Link) |
| Vendor Page | Anti RBP3 pAb (ATL-HPA041301) |