Anti RBP3 pAb (ATL-HPA041301)

Atlas Antibodies

Catalog No.: ATL-HPA041301-25

Protein Description: retinol binding protein 3, interstitial
Gene Name: RBP3
Alternative Gene Name: D10S64, D10S65, D10S66, RP66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041534: 90%, ENSRNOG00000051911: 92%
Entrez Gene ID: 5949
Uniprot ID: P10745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDR
• Gene Sequence: GVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDR
• Gene ID - Mouse: ENSMUSG00000041534
• Gene ID - Rat: ENSRNOG00000051911
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.