Anti RBMS1 pAb (ATL-HPA047943)

Atlas Antibodies

Catalog No.:
ATL-HPA047943-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RNA binding motif, single stranded interacting protein 1
Gene Name: RBMS1
Alternative Gene Name: C2orf12, DKFZp564H0764, HCC-4, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026970: 95%, ENSRNOG00000008482: 91%
Entrez Gene ID: 5937
Uniprot ID: P29558
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSTGTYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK
Gene Sequence GSTGTYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK
Gene ID - Mouse ENSMUSG00000026970
Gene ID - Rat ENSRNOG00000008482
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBMS1 pAb (ATL-HPA047943)
Datasheet Anti RBMS1 pAb (ATL-HPA047943) Datasheet (External Link)
Vendor Page Anti RBMS1 pAb (ATL-HPA047943) at Atlas Antibodies

Documents & Links for Anti RBMS1 pAb (ATL-HPA047943)
Datasheet Anti RBMS1 pAb (ATL-HPA047943) Datasheet (External Link)
Vendor Page Anti RBMS1 pAb (ATL-HPA047943)