Anti RBM7 pAb (ATL-HPA048003)

Atlas Antibodies

Catalog No.:
ATL-HPA048003-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 7
Gene Name: RBM7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042396: 83%, ENSRNOG00000005710: 83%
Entrez Gene ID: 10179
Uniprot ID: Q9Y580
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRR
Gene Sequence SSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRR
Gene ID - Mouse ENSMUSG00000042396
Gene ID - Rat ENSRNOG00000005710
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM7 pAb (ATL-HPA048003)
Datasheet Anti RBM7 pAb (ATL-HPA048003) Datasheet (External Link)
Vendor Page Anti RBM7 pAb (ATL-HPA048003) at Atlas Antibodies

Documents & Links for Anti RBM7 pAb (ATL-HPA048003)
Datasheet Anti RBM7 pAb (ATL-HPA048003) Datasheet (External Link)
Vendor Page Anti RBM7 pAb (ATL-HPA048003)