Anti RBM6 pAb (ATL-HPA027164 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027164-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 6
Gene Name: RBM6
Alternative Gene Name: 3G2, DEF-3, DEF3, g16, NY-LU-12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032582: 82%, ENSRNOG00000018333: 85%
Entrez Gene ID: 10180
Uniprot ID: P78332
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEH
Gene Sequence DFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEH
Gene ID - Mouse ENSMUSG00000032582
Gene ID - Rat ENSRNOG00000018333
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM6 pAb (ATL-HPA027164 w/enhanced validation)
Datasheet Anti RBM6 pAb (ATL-HPA027164 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RBM6 pAb (ATL-HPA027164 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RBM6 pAb (ATL-HPA027164 w/enhanced validation)
Datasheet Anti RBM6 pAb (ATL-HPA027164 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RBM6 pAb (ATL-HPA027164 w/enhanced validation)