Anti RBM45 pAb (ATL-HPA020448)

Atlas Antibodies

Catalog No.:
ATL-HPA020448-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 45
Gene Name: RBM45
Alternative Gene Name: DRB1, FLJ44612
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042369: 96%, ENSRNOG00000010595: 98%
Entrez Gene ID: 129831
Uniprot ID: Q8IUH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEE
Gene Sequence VDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEE
Gene ID - Mouse ENSMUSG00000042369
Gene ID - Rat ENSRNOG00000010595
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM45 pAb (ATL-HPA020448)
Datasheet Anti RBM45 pAb (ATL-HPA020448) Datasheet (External Link)
Vendor Page Anti RBM45 pAb (ATL-HPA020448) at Atlas Antibodies

Documents & Links for Anti RBM45 pAb (ATL-HPA020448)
Datasheet Anti RBM45 pAb (ATL-HPA020448) Datasheet (External Link)
Vendor Page Anti RBM45 pAb (ATL-HPA020448)
Citations for Anti RBM45 pAb (ATL-HPA020448) – 3 Found
Bakkar, Nadine; Kousari, Arianna; Kovalik, Tina; Li, Yang; Bowser, Robert. RBM45 Modulates the Antioxidant Response in Amyotrophic Lateral Sclerosis through Interactions with KEAP1. Molecular And Cellular Biology. 2015;35(14):2385-99.  PubMed
Wei, Christina; Stock, Lauren; Valanejad, Leila; Zalewski, Zachary A; Karns, Rebekah; Puymirat, Jack; Nelson, David; Witte, David; Woodgett, Jim; Timchenko, Nikolai A; Timchenko, Lubov. Correction of GSK3β at young age prevents muscle pathology in mice with myotonic dystrophy type 1. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2018;32(4):2073-2085.  PubMed
Collins, Mahlon; Riascos, David; Kovalik, Tina; An, Jiyan; Krupa, Kelly; Krupa, Kristin; Hood, Brian L; Conrads, Thomas P; Renton, Alan E; Traynor, Bryan J; Bowser, Robert. The RNA-binding motif 45 (RBM45) protein accumulates in inclusion bodies in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP) patients. Acta Neuropathologica. 2012;124(5):717-32.  PubMed