Anti RBM4 pAb (ATL-HPA047849)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047849-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RBM4
Alternative Gene Name: LARK, RBM4A, ZCCHC21, ZCRB3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033760: 93%, ENSRNOG00000061795: 98%
Entrez Gene ID: 5936
Uniprot ID: Q9BWF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTVGEGYGYGPESELSQASAATRNSLYDMARYEREQYVDRARYSA |
| Gene Sequence | PTVGEGYGYGPESELSQASAATRNSLYDMARYEREQYVDRARYSA |
| Gene ID - Mouse | ENSMUSG00000033760 |
| Gene ID - Rat | ENSRNOG00000061795 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RBM4 pAb (ATL-HPA047849) | |
| Datasheet | Anti RBM4 pAb (ATL-HPA047849) Datasheet (External Link) |
| Vendor Page | Anti RBM4 pAb (ATL-HPA047849) at Atlas Antibodies |
| Documents & Links for Anti RBM4 pAb (ATL-HPA047849) | |
| Datasheet | Anti RBM4 pAb (ATL-HPA047849) Datasheet (External Link) |
| Vendor Page | Anti RBM4 pAb (ATL-HPA047849) |
| Citations for Anti RBM4 pAb (ATL-HPA047849) – 1 Found |
| Vihola, Anna; Palmio, Johanna; Danielsson, Olof; Penttilä, Sini; Louiselle, Daniel; Pittman, Sara; Weihl, Conrad; Udd, Bjarne. Novel mutation in TNPO3 causes congenital limb-girdle myopathy with slow progression. Neurology. Genetics. 2019;5(3):e337. PubMed |