Anti RBM39 pAb (ATL-HPA001591 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001591-100

Protein Description: RNA binding motif protein 39
Gene Name: RBM39
Alternative Gene Name: CAPER, CAPERalpha, CC1.3, fSAP59, HCC1, RNPC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027620: 100%, ENSRNOG00000049814: 100%
Entrez Gene ID: 9584
Uniprot ID: Q14498
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ
• Gene Sequence: LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ
• Gene ID - Mouse: ENSMUSG00000027620
• Gene ID - Rat: ENSRNOG00000049814
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBM39 pAb (ATL-HPA001591 w/enhanced validation) – 9 Found

Faherty, Noel; Benson, Matthew; Sharma, Eshita; Lee, Angela; Howarth, Alison; Lockstone, Helen; Ebner, Daniel; Bhattacharya, Shoumo. Negative autoregulation of BMP dependent transcription by SIN3B splicing reveals a role for RBM39. Scientific Reports. 2016;6( 27324164):28210. 

Lu, Gang; Weng, Stephanie; Matyskiela, Mary; Zheng, Xinde; Fang, Wei; Wood, Scott; Surka, Christine; Mizukoshi, Reina; Lu, Chin-Chun; Mendy, Derek; Jang, In Sock; Wang, Kai; Marella, Mathieu; Couto, Suzana; Cathers, Brian; Carmichael, James; Chamberlain, Philip; Rolfe, Mark. UBE2G1 governs the destruction of cereblon neomorphic substrates. Elife. 2018;7( 30234487) 

Yamanaka, Satoshi; Horiuchi, Yuto; Matsuoka, Saya; Kido, Kohki; Nishino, Kohei; Maeno, Mayaka; Shibata, Norio; Kosako, Hidetaka; Sawasaki, Tatsuya. A proximity biotinylation-based approach to identify protein-E3 ligase interactions induced by PROTACs and molecular glues. Nature Communications. 2022;13(1):183. 

Pogacar, Ziva; Groot, Kelvin; Jochems, Fleur; Dos Santos Dias, Matheus; Mulero-Sánchez, Antonio; Morris, Ben; Roosen, Mieke; Wardak, Leyma; De Conti, Giulia; Velds, Arno; Lieftink, Cor; Thijssen, Bram; Beijersbergen, Roderick L; Bernards, René; Leite de Oliveira, Rodrigo. Genetic and compound screens uncover factors modulating cancer cell response to indisulam. Life Science Alliance. 2022;5(9) 

Sillars-Hardebol, Anke H; Carvalho, Beatriz; Beliën, Jeroen A M; de Wit, Meike; Delis-van Diemen, Pien M; Tijssen, Marianne; van de Wiel, Mark A; Pontén, Fredrik; Meijer, Gerrit A; Fijneman, Remond J A. CSE1L, DIDO1 and RBM39 in colorectal adenoma to carcinoma progression. Cellular Oncology (Dordrecht). 2012;35(4):293-300. 

Královicová, Jana; Ševcíková, Ivana; Stejskalová, Eva; Obuca, Mina; Hiller, Michael; Stanek, David; Vorechovský, Igor. PUF60-activated exons uncover altered 3' splice-site selection by germline missense mutations in a single RRM. Nucleic Acids Research. 2018;46(12):6166-6187. 

Gaucherand, Lea; Porter, Brittany K; Levene, Rachel E; Price, Emma L; Schmaling, Summer K; Rycroft, Chris H; Kevorkian, Yuzo; McCormick, Craig; Khaperskyy, Denys A; Gaglia, Marta M. The Influenza A Virus Endoribonuclease PA-X Usurps Host mRNA Processing Machinery to Limit Host Gene Expression. Cell Reports. 2019;27(3):776-792.e7. 

Nijhuis, Anke; Sikka, Arti; Yogev, Orli; Herendi, Lili; Balcells, Cristina; Ma, Yurui; Poon, Evon; Eckold, Clare; Valbuena, Gabriel N; Xu, Yuewei; Liu, Yusong; da Costa, Barbara Martins; Gruet, Michael; Wickremesinghe, Chiharu; Benito, Adrian; Kramer, Holger; Montoya, Alex; Carling, David; Want, Elizabeth J; Jamin, Yann; Chesler, Louis; Keun, Hector C. Indisulam targets RNA splicing and metabolism to serve as a therapeutic strategy for high-risk neuroblastoma. Nature Communications. 2022;13(1):1380. 

Lu, Sydney X; De Neef, Emma; Thomas, James D; Sabio, Erich; Rousseau, Benoit; Gigoux, Mathieu; Knorr, David A; Greenbaum, Benjamin; Elhanati, Yuval; Hogg, Simon J; Chow, Andrew; Ghosh, Arnab; Xie, Abigail; Zamarin, Dmitriy; Cui, Daniel; Erickson, Caroline; Singer, Michael; Cho, Hana; Wang, Eric; Lu, Bin; Durham, Benjamin H; Shah, Harshal; Chowell, Diego; Gabel, Austin M; Shen, Yudao; Liu, Jing; Jin, Jian; Rhodes, Matthew C; Taylor, Richard E; Molina, Henrik; Wolchok, Jedd D; Merghoub, Taha; Diaz, Luis A Jr; Abdel-Wahab, Omar; Bradley, Robert K. Pharmacologic modulation of RNA splicing enhances anti-tumor immunity. Cell. 2021;184(15):4032-4047.e31.