Anti RBM34 pAb (ATL-HPA028606)

Atlas Antibodies

Catalog No.: ATL-HPA028606-25

Protein Description: RNA binding motif protein 34
Gene Name: RBM34
Alternative Gene Name: KIAA0117
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033931: 52%, ENSRNOG00000020004: 53%
Entrez Gene ID: 23029
Uniprot ID: P42696
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQVASSLFRGEHHSRGGTGRLASLFSSLEPQIQPVYVPVPKQTIKKTKRNEEEESTSQIERPLSQEPAKKVKAKKKHTNA
• Gene Sequence: GQVASSLFRGEHHSRGGTGRLASLFSSLEPQIQPVYVPVPKQTIKKTKRNEEEESTSQIERPLSQEPAKKVKAKKKHTNA
• Gene ID - Mouse: ENSMUSG00000033931
• Gene ID - Rat: ENSRNOG00000020004
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.