Anti RBM12B pAb (ATL-HPA024398)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024398-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RBM12B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052137: 74%, ENSRNOG00000055292: 74%
Entrez Gene ID: 389677
Uniprot ID: Q8IXT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKK |
| Gene Sequence | NLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKK |
| Gene ID - Mouse | ENSMUSG00000052137 |
| Gene ID - Rat | ENSRNOG00000055292 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RBM12B pAb (ATL-HPA024398) | |
| Datasheet | Anti RBM12B pAb (ATL-HPA024398) Datasheet (External Link) |
| Vendor Page | Anti RBM12B pAb (ATL-HPA024398) at Atlas Antibodies |
| Documents & Links for Anti RBM12B pAb (ATL-HPA024398) | |
| Datasheet | Anti RBM12B pAb (ATL-HPA024398) Datasheet (External Link) |
| Vendor Page | Anti RBM12B pAb (ATL-HPA024398) |