Anti RBM12B pAb (ATL-HPA024398)

Atlas Antibodies

Catalog No.: ATL-HPA024398-25

Protein Description: RNA binding motif protein 12B
Gene Name: RBM12B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052137: 74%, ENSRNOG00000055292: 74%
Entrez Gene ID: 389677
Uniprot ID: Q8IXT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKK
• Gene Sequence: NLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKK
• Gene ID - Mouse: ENSMUSG00000052137
• Gene ID - Rat: ENSRNOG00000055292
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.