Anti RBFOX3 pAb (ATL-HPA030790 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030790-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RBFOX3
Alternative Gene Name: FOX-3, HRNBP3, NeuN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025576: 93%, ENSRNOG00000003386: 94%
Entrez Gene ID: 146713
Uniprot ID: A6NFN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ |
| Gene Sequence | PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ |
| Gene ID - Mouse | ENSMUSG00000025576 |
| Gene ID - Rat | ENSRNOG00000003386 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RBFOX3 pAb (ATL-HPA030790 w/enhanced validation) | |
| Datasheet | Anti RBFOX3 pAb (ATL-HPA030790 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RBFOX3 pAb (ATL-HPA030790 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RBFOX3 pAb (ATL-HPA030790 w/enhanced validation) | |
| Datasheet | Anti RBFOX3 pAb (ATL-HPA030790 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RBFOX3 pAb (ATL-HPA030790 w/enhanced validation) |
| Citations for Anti RBFOX3 pAb (ATL-HPA030790 w/enhanced validation) – 3 Found |
| Xu, Tingting; Li, Xiaofei; Guo, Yuxi; Uhlin, Elias; Holmberg, Lena; Mitra, Sumonto; Winn, Dania; Falk, Anna; Sundström, Erik. Multiple therapeutic effects of human neural stem cells derived from induced pluripotent stem cells in a rat model of post-traumatic syringomyelia. Ebiomedicine. 2022;77( 35182996):103882. PubMed |
| Bergmann, Olaf; Liebl, Jakob; Bernard, Samuel; Alkass, Kanar; Yeung, Maggie S Y; Steier, Peter; Kutschera, Walter; Johnson, Lars; Landén, Mikael; Druid, Henrik; Spalding, Kirsty L; Frisén, Jonas. The age of olfactory bulb neurons in humans. Neuron. 2012;74(4):634-9. PubMed |
| Huttner, Hagen B; Bergmann, Olaf; Salehpour, Mehran; Rácz, Attila; Tatarishvili, Jemal; Lindgren, Emma; Csonka, Tamás; Csiba, László; Hortobágyi, Tibor; Méhes, Gábor; Englund, Elisabet; Solnestam, Beata Werne; Zdunek, Sofia; Scharenberg, Christian; Ström, Lena; Ståhl, Patrik; Sigurgeirsson, Benjamin; Dahl, Andreas; Schwab, Stefan; Possnert, Göran; Bernard, Samuel; Kokaia, Zaal; Lindvall, Olle; Lundeberg, Joakim; Frisén, Jonas. The age and genomic integrity of neurons after cortical stroke in humans. Nature Neuroscience. 2014;17(6):801-3. PubMed |