Anti RBCK1 pAb (ATL-HPA024185 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024185-25

Protein Description: RanBP-type and C3HC4-type zinc finger containing 1
Gene Name: RBCK1
Alternative Gene Name: C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027466: 87%, ENSRNOG00000006695: 88%
Entrez Gene ID: 10616
Uniprot ID: Q9BYM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
• Gene Sequence: SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
• Gene ID - Mouse: ENSMUSG00000027466
• Gene ID - Rat: ENSRNOG00000006695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBCK1 pAb (ATL-HPA024185 w/enhanced validation) – 6 Found

Strickson, Sam; Emmerich, Christoph H; Goh, Eddy T H; Zhang, Jiazhen; Kelsall, Ian R; Macartney, Thomas; Hastie, C James; Knebel, Axel; Peggie, Mark; Marchesi, Francesco; Arthur, J Simon C; Cohen, Philip. Roles of the TRAF6 and Pellino E3 ligases in MyD88 and RANKL signaling. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(17):E3481-E3489. 

Kelsall, Ian R; McCrory, Elisha H; Xu, Yingqi; Scudamore, Cheryl L; Nanda, Sambit K; Mancebo-Gamella, Paula; Wood, Nicola T; Knebel, Axel; Matthews, Stephen J; Cohen, Philip. HOIL-1 ubiquitin ligase activity targets unbranched glucosaccharides and is required to prevent polyglucosan accumulation. The Embo Journal. 2022;41(8):e109700. 

Lewis, Myles J; Vyse, Simon; Shields, Adrian M; Boeltz, Sebastian; Gordon, Patrick A; Spector, Timothy D; Lehner, Paul J; Walczak, Henning; Vyse, Timothy J. UBE2L3 polymorphism amplifies NF-κB activation and promotes plasma cell development, linking linear ubiquitination to multiple autoimmune diseases. American Journal Of Human Genetics. 2015;96(2):221-34. 

Klein, Theo; Fung, Shan-Yu; Renner, Florian; Blank, Michael A; Dufour, Antoine; Kang, Sohyeong; Bolger-Munro, Madison; Scurll, Joshua M; Priatel, John J; Schweigler, Patrick; Melkko, Samu; Gold, Michael R; Viner, Rosa I; Régnier, Catherine H; Turvey, Stuart E; Overall, Christopher M. The paracaspase MALT1 cleaves HOIL1 reducing linear ubiquitination by LUBAC to dampen lymphocyte NF-κB signalling. Nature Communications. 2015;6( 26525107):8777. 

de Jong, Maarten F; Liu, Zixu; Chen, Didi; Alto, Neal M. Shigella flexneri suppresses NF-κB activation by inhibiting linear ubiquitin chain ligation. Nature Microbiology. 2016;1(7):16084. 

Bao, Wei; Sun, Chenxia; Sun, Xiaochen; He, Miaoxia; Yu, Haolan; Yan, Wenfen; Wen, Fuping; Zhang, Liang; Yang, Chenghua. Targeting BCL10 by small peptides for the treatment of B cell lymphoma. Theranostics. 10(25):11622-11636.