Anti RAVER2 pAb (ATL-HPA045785)

Atlas Antibodies

Catalog No.:
ATL-HPA045785-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ribonucleoprotein, PTB-binding 2
Gene Name: RAVER2
Alternative Gene Name: FLJ10770, KIAA1579
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035275: 79%, ENSRNOG00000023812: 80%
Entrez Gene ID: 55225
Uniprot ID: Q9HCJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTG
Gene Sequence SPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTG
Gene ID - Mouse ENSMUSG00000035275
Gene ID - Rat ENSRNOG00000023812
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAVER2 pAb (ATL-HPA045785)
Datasheet Anti RAVER2 pAb (ATL-HPA045785) Datasheet (External Link)
Vendor Page Anti RAVER2 pAb (ATL-HPA045785) at Atlas Antibodies

Documents & Links for Anti RAVER2 pAb (ATL-HPA045785)
Datasheet Anti RAVER2 pAb (ATL-HPA045785) Datasheet (External Link)
Vendor Page Anti RAVER2 pAb (ATL-HPA045785)