Anti RASSF10 pAb (ATL-HPA040406)

Atlas Antibodies

Catalog No.: ATL-HPA040406-25

Protein Description: Ras association domain family member 10
Gene Name: RASSF10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098132: 92%, ENSRNOG00000014847: 90%
Entrez Gene ID: 644943
Uniprot ID: A6NK89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEA
• Gene Sequence: RRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEA
• Gene ID - Mouse: ENSMUSG00000098132
• Gene ID - Rat: ENSRNOG00000014847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.