Anti RASSF10 pAb (ATL-HPA040406)

Atlas Antibodies

Catalog No.:
ATL-HPA040406-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Ras association domain family member 10
Gene Name: RASSF10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098132: 92%, ENSRNOG00000014847: 90%
Entrez Gene ID: 644943
Uniprot ID: A6NK89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEA
Gene Sequence RRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEA
Gene ID - Mouse ENSMUSG00000098132
Gene ID - Rat ENSRNOG00000014847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASSF10 pAb (ATL-HPA040406)
Datasheet Anti RASSF10 pAb (ATL-HPA040406) Datasheet (External Link)
Vendor Page Anti RASSF10 pAb (ATL-HPA040406) at Atlas Antibodies

Documents & Links for Anti RASSF10 pAb (ATL-HPA040406)
Datasheet Anti RASSF10 pAb (ATL-HPA040406) Datasheet (External Link)
Vendor Page Anti RASSF10 pAb (ATL-HPA040406)