Anti RASGEF1B pAb (ATL-HPA044574)

Atlas Antibodies

Catalog No.:
ATL-HPA044574-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RasGEF domain family, member 1B
Gene Name: RASGEF1B
Alternative Gene Name: FLJ31695, GPIG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089809: 95%, ENSRNOG00000002345: 92%
Entrez Gene ID: 153020
Uniprot ID: Q0VAM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDERMMRNLKDLAHRIASGEETYRKNVQQMMQCLIRKLAALSQYEEVLAKISSTSTDRLTVLKTKPQSIQRDIITVC
Gene Sequence RDERMMRNLKDLAHRIASGEETYRKNVQQMMQCLIRKLAALSQYEEVLAKISSTSTDRLTVLKTKPQSIQRDIITVC
Gene ID - Mouse ENSMUSG00000089809
Gene ID - Rat ENSRNOG00000002345
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASGEF1B pAb (ATL-HPA044574)
Datasheet Anti RASGEF1B pAb (ATL-HPA044574) Datasheet (External Link)
Vendor Page Anti RASGEF1B pAb (ATL-HPA044574) at Atlas Antibodies

Documents & Links for Anti RASGEF1B pAb (ATL-HPA044574)
Datasheet Anti RASGEF1B pAb (ATL-HPA044574) Datasheet (External Link)
Vendor Page Anti RASGEF1B pAb (ATL-HPA044574)