Anti RARS2 pAb (ATL-HPA039987)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039987-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RARS2
Alternative Gene Name: DALRD2, dJ382I10.6, MGC14993, MGC23778, PRO1992, RARSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028292: 76%, ENSRNOG00000008643: 75%
Entrez Gene ID: 57038
Uniprot ID: Q5T160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLP |
| Gene Sequence | LSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLP |
| Gene ID - Mouse | ENSMUSG00000028292 |
| Gene ID - Rat | ENSRNOG00000008643 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RARS2 pAb (ATL-HPA039987) | |
| Datasheet | Anti RARS2 pAb (ATL-HPA039987) Datasheet (External Link) |
| Vendor Page | Anti RARS2 pAb (ATL-HPA039987) at Atlas Antibodies |
| Documents & Links for Anti RARS2 pAb (ATL-HPA039987) | |
| Datasheet | Anti RARS2 pAb (ATL-HPA039987) Datasheet (External Link) |
| Vendor Page | Anti RARS2 pAb (ATL-HPA039987) |