Anti RARS2 pAb (ATL-HPA039987)

Atlas Antibodies

Catalog No.:
ATL-HPA039987-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: arginyl-tRNA synthetase 2, mitochondrial
Gene Name: RARS2
Alternative Gene Name: DALRD2, dJ382I10.6, MGC14993, MGC23778, PRO1992, RARSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028292: 76%, ENSRNOG00000008643: 75%
Entrez Gene ID: 57038
Uniprot ID: Q5T160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLP
Gene Sequence LSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLP
Gene ID - Mouse ENSMUSG00000028292
Gene ID - Rat ENSRNOG00000008643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RARS2 pAb (ATL-HPA039987)
Datasheet Anti RARS2 pAb (ATL-HPA039987) Datasheet (External Link)
Vendor Page Anti RARS2 pAb (ATL-HPA039987) at Atlas Antibodies

Documents & Links for Anti RARS2 pAb (ATL-HPA039987)
Datasheet Anti RARS2 pAb (ATL-HPA039987) Datasheet (External Link)
Vendor Page Anti RARS2 pAb (ATL-HPA039987)