Anti RAP1GDS1 pAb (ATL-HPA019060)

Atlas Antibodies

Catalog No.: ATL-HPA019060-25

Protein Description: RAP1, GTP-GDP dissociation stimulator 1
Gene Name: RAP1GDS1
Alternative Gene Name: SmgGDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028149: 96%, ENSRNOG00000015987: 94%
Entrez Gene ID: 5910
Uniprot ID: P52306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESSKQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGA
• Gene Sequence: ESSKQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGA
• Gene ID - Mouse: ENSMUSG00000028149
• Gene ID - Rat: ENSRNOG00000015987
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAP1GDS1 pAb (ATL-HPA019060) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.