Anti RAF1 pAb (ATL-HPA002640)

Atlas Antibodies

Catalog No.: ATL-HPA002640-25

Protein Description: Raf-1 proto-oncogene, serine/threonine kinase
Gene Name: RAF1
Alternative Gene Name: c-Raf, CRAF, Raf-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000441: 96%, ENSRNOG00000010153: 97%
Entrez Gene ID: 5894
Uniprot ID: P04049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQ
• Gene Sequence: FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQ
• Gene ID - Mouse: ENSMUSG00000000441
• Gene ID - Rat: ENSRNOG00000010153
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAF1 pAb (ATL-HPA002640) – 1 Found

Bekele, Raie T; Samant, Amruta S; Nassar, Amin H; So, Jonathan; Garcia, Elizabeth P; Curran, Catherine R; Hwang, Justin H; Mayhew, David L; Nag, Anwesha; Thorner, Aaron R; Börcsök, Judit; Sztupinszki, Zsofia; Pan, Chong-Xian; Bellmunt, Joaquim; Kwiatkowski, David J; Sonpavde, Guru P; Van Allen, Eliezer M; Mouw, Kent W. RAF1 amplification drives a subset of bladder tumors and confers sensitivity to MAPK-directed therapeutics. The Journal Of Clinical Investigation. 2021;131(22)