Anti RAD9B pAb (ATL-HPA040643)

Atlas Antibodies

Catalog No.:
ATL-HPA040643-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAD9 homolog B (S. pombe)
Gene Name: RAD9B
Alternative Gene Name: FLJ40346
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038569: 64%, ENSRNOG00000021480: 66%
Entrez Gene ID: 144715
Uniprot ID: Q6WBX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMD
Gene Sequence RHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMD
Gene ID - Mouse ENSMUSG00000038569
Gene ID - Rat ENSRNOG00000021480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAD9B pAb (ATL-HPA040643)
Datasheet Anti RAD9B pAb (ATL-HPA040643) Datasheet (External Link)
Vendor Page Anti RAD9B pAb (ATL-HPA040643) at Atlas Antibodies

Documents & Links for Anti RAD9B pAb (ATL-HPA040643)
Datasheet Anti RAD9B pAb (ATL-HPA040643) Datasheet (External Link)
Vendor Page Anti RAD9B pAb (ATL-HPA040643)