Anti RAD51C pAb (ATL-HPA045198)

Atlas Antibodies

Catalog No.:
ATL-HPA045198-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: RAD51 paralog C
Gene Name: RAD51C
Alternative Gene Name: FANCO, RAD51L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007646: 79%, ENSRNOG00000006661: 82%
Entrez Gene ID: 5889
Uniprot ID: O43502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVG
Gene Sequence MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVG
Gene ID - Mouse ENSMUSG00000007646
Gene ID - Rat ENSRNOG00000006661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAD51C pAb (ATL-HPA045198)
Datasheet Anti RAD51C pAb (ATL-HPA045198) Datasheet (External Link)
Vendor Page Anti RAD51C pAb (ATL-HPA045198) at Atlas Antibodies

Documents & Links for Anti RAD51C pAb (ATL-HPA045198)
Datasheet Anti RAD51C pAb (ATL-HPA045198) Datasheet (External Link)
Vendor Page Anti RAD51C pAb (ATL-HPA045198)