Anti RABL2A pAb (ATL-HPA044007)

Atlas Antibodies

Catalog No.: ATL-HPA044007-25

Protein Description: RAB, member of RAS oncogene family-like 2A
Gene Name: RABL2A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022621: 84%, ENSRNOG00000013947: 89%
Entrez Gene ID: 11159
Uniprot ID: Q9UBK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATV
• Gene Sequence: DKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATV
• Gene ID - Mouse: ENSMUSG00000022621
• Gene ID - Rat: ENSRNOG00000013947
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.