Anti RABGGTB pAb (ATL-HPA026585)

Atlas Antibodies

Catalog No.: ATL-HPA026585-100

Protein Description: Rab geranylgeranyltransferase, beta subunit
Gene Name: RABGGTB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038975: 97%, ENSRNOG00000009992: 96%
Entrez Gene ID: 5876
Uniprot ID: P53611
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
• Gene Sequence: REKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
• Gene ID - Mouse: ENSMUSG00000038975
• Gene ID - Rat: ENSRNOG00000009992
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.