Anti RAB5C pAb (ATL-HPA004167)

Atlas Antibodies

Catalog No.: ATL-HPA004167-25

Protein Description: RAB5C, member RAS oncogene family
Gene Name: RAB5C
Alternative Gene Name: RAB5CL, RABL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019173: 95%, ENSRNOG00000018568: 97%
Entrez Gene ID: 5878
Uniprot ID: P51148
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
• Gene Sequence: NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
• Gene ID - Mouse: ENSMUSG00000019173
• Gene ID - Rat: ENSRNOG00000018568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.