Anti RAB5C pAb (ATL-HPA004167)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004167-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RAB5C
Alternative Gene Name: RAB5CL, RABL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019173: 95%, ENSRNOG00000018568: 97%
Entrez Gene ID: 5878
Uniprot ID: P51148
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
| Gene Sequence | NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
| Gene ID - Mouse | ENSMUSG00000019173 |
| Gene ID - Rat | ENSRNOG00000018568 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RAB5C pAb (ATL-HPA004167) | |
| Datasheet | Anti RAB5C pAb (ATL-HPA004167) Datasheet (External Link) |
| Vendor Page | Anti RAB5C pAb (ATL-HPA004167) at Atlas Antibodies |
| Documents & Links for Anti RAB5C pAb (ATL-HPA004167) | |
| Datasheet | Anti RAB5C pAb (ATL-HPA004167) Datasheet (External Link) |
| Vendor Page | Anti RAB5C pAb (ATL-HPA004167) |