Anti RAB5C pAb (ATL-HPA003426 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003426-25

Protein Description: RAB5C, member RAS oncogene family
Gene Name: RAB5C
Alternative Gene Name: RAB5CL, RABL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019173: 95%, ENSRNOG00000018568: 97%
Entrez Gene ID: 5878
Uniprot ID: P51148
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
• Gene Sequence: NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
• Gene ID - Mouse: ENSMUSG00000019173
• Gene ID - Rat: ENSRNOG00000018568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAB5C pAb (ATL-HPA003426 w/enhanced validation) – 6 Found

Chen, Pin-I; Kong, Chen; Su, Xiong; Stahl, Philip D. Rab5 isoforms differentially regulate the trafficking and degradation of epidermal growth factor receptors. The Journal Of Biological Chemistry. 2009;284(44):30328-38. 

Jiwani, Shahanawaz; Wang, Yi; Dowd, Georgina C; Gianfelice, Antonella; Pichestapong, Phannipha; Gavicherla, Balramakrishna; Vanbennekom, Neyda; Ireton, Keith. Identification of components of the host type IA phosphoinositide 3-kinase pathway that promote internalization of Listeria monocytogenes. Infection And Immunity. 2012;80(3):1252-66. 

Yoon, Sena; Han, Eunji; Choi, Young-Chul; Kee, Honghwan; Jeong, Yongsu; Yoon, Jaeseung; Baek, Kwanghee. Inhibition of cell proliferation and migration by miR-509-3p that targets CDK2, Rac1, and PIK3C2A. Molecules And Cells. 2014;37(4):314-21. 

Dowd, Georgina C; Bhalla, Manmeet; Kean, Bernard; Thomas, Rowan; Ireton, Keith. Role of Host Type IA Phosphoinositide 3-Kinase Pathway Components in Invasin-Mediated Internalization of Yersinia enterocolitica. Infection And Immunity. 2016;84(6):1826-1841. 

Franke, Christian; Repnik, Urska; Segeletz, Sandra; Brouilly, Nicolas; Kalaidzidis, Yannis; Verbavatz, Jean-Marc; Zerial, Marino. Correlative single-molecule localization microscopy and electron tomography reveals endosome nanoscale domains. Traffic (Copenhagen, Denmark). 2019;20(8):601-617. 

Kumar, Harsh; Pushpa, Kumari; Kumari, Amrita; Verma, Kuldeep; Pergu, Rajaiah; Mylavarapu, Sivaram V S. The exocyst complex and Rab5 are required for abscission by localizing ESCRT III subunits to the cytokinetic bridge. Journal Of Cell Science. 2019;132(14)