Anti RAB33B pAb (ATL-HPA048367)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048367-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RAB33B
Alternative Gene Name: DKFZP434G099
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027739: 87%, ENSRNOG00000013035: 89%
Entrez Gene ID: 83452
Uniprot ID: Q9H082
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV |
| Gene Sequence | MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV |
| Gene ID - Mouse | ENSMUSG00000027739 |
| Gene ID - Rat | ENSRNOG00000013035 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RAB33B pAb (ATL-HPA048367) | |
| Datasheet | Anti RAB33B pAb (ATL-HPA048367) Datasheet (External Link) |
| Vendor Page | Anti RAB33B pAb (ATL-HPA048367) at Atlas Antibodies |
| Documents & Links for Anti RAB33B pAb (ATL-HPA048367) | |
| Datasheet | Anti RAB33B pAb (ATL-HPA048367) Datasheet (External Link) |
| Vendor Page | Anti RAB33B pAb (ATL-HPA048367) |