Anti RAB14 pAb (ATL-HPA026419)

Atlas Antibodies

Catalog No.:
ATL-HPA026419-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: RAB14, member RAS oncogene family
Gene Name: RAB14
Alternative Gene Name: FBP, RAB-14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026878: 100%, ENSRNOG00000018901: 100%
Entrez Gene ID: 51552
Uniprot ID: P61106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ
Gene Sequence GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ
Gene ID - Mouse ENSMUSG00000026878
Gene ID - Rat ENSRNOG00000018901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAB14 pAb (ATL-HPA026419)
Datasheet Anti RAB14 pAb (ATL-HPA026419) Datasheet (External Link)
Vendor Page Anti RAB14 pAb (ATL-HPA026419) at Atlas Antibodies

Documents & Links for Anti RAB14 pAb (ATL-HPA026419)
Datasheet Anti RAB14 pAb (ATL-HPA026419) Datasheet (External Link)
Vendor Page Anti RAB14 pAb (ATL-HPA026419)