Anti QRFPR pAb (ATL-HPA014300)

Atlas Antibodies

Catalog No.: ATL-HPA014300-25

Protein Description: pyroglutamylated RFamide peptide receptor
Gene Name: QRFPR
Alternative Gene Name: GPR103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058400: 85%, ENSRNOG00000014414: 83%
Entrez Gene ID: 84109
Uniprot ID: Q96P65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLA
• Gene Sequence: MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLA
• Gene ID - Mouse: ENSMUSG00000058400
• Gene ID - Rat: ENSRNOG00000014414
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti QRFPR pAb (ATL-HPA014300) – 1 Found

Lindskog, Cecilia; Korsgren, Olle; Pontén, Fredrik; Eriksson, Jan W; Johansson, Lars; Danielsson, Angelika. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. Journal Of Proteomics. 2012;75(9):2611-20.