Anti QRFPR pAb (ATL-HPA014300)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014300-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: QRFPR
Alternative Gene Name: GPR103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058400: 85%, ENSRNOG00000014414: 83%
Entrez Gene ID: 84109
Uniprot ID: Q96P65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLA |
| Gene Sequence | MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLA |
| Gene ID - Mouse | ENSMUSG00000058400 |
| Gene ID - Rat | ENSRNOG00000014414 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti QRFPR pAb (ATL-HPA014300) | |
| Datasheet | Anti QRFPR pAb (ATL-HPA014300) Datasheet (External Link) |
| Vendor Page | Anti QRFPR pAb (ATL-HPA014300) at Atlas Antibodies |
| Documents & Links for Anti QRFPR pAb (ATL-HPA014300) | |
| Datasheet | Anti QRFPR pAb (ATL-HPA014300) Datasheet (External Link) |
| Vendor Page | Anti QRFPR pAb (ATL-HPA014300) |
| Citations for Anti QRFPR pAb (ATL-HPA014300) – 1 Found |
| Lindskog, Cecilia; Korsgren, Olle; Pontén, Fredrik; Eriksson, Jan W; Johansson, Lars; Danielsson, Angelika. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. Journal Of Proteomics. 2012;75(9):2611-20. PubMed |