Anti QKI pAb (ATL-HPA019123 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019123-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: QKI
Alternative Gene Name: QK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062078: 100%, ENSRNOG00000048297: 100%
Entrez Gene ID: 9444
Uniprot ID: Q96PU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVL |
| Gene Sequence | RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVL |
| Gene ID - Mouse | ENSMUSG00000062078 |
| Gene ID - Rat | ENSRNOG00000048297 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti QKI pAb (ATL-HPA019123 w/enhanced validation) | |
| Datasheet | Anti QKI pAb (ATL-HPA019123 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti QKI pAb (ATL-HPA019123 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti QKI pAb (ATL-HPA019123 w/enhanced validation) | |
| Datasheet | Anti QKI pAb (ATL-HPA019123 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti QKI pAb (ATL-HPA019123 w/enhanced validation) |
| Citations for Anti QKI pAb (ATL-HPA019123 w/enhanced validation) – 7 Found |
| Suiko, Takahiko; Kobayashi, Kensuke; Aono, Kentaro; Kawashima, Togo; Inoue, Kiyoshi; Ku, Li; Feng, Yue; Koike, Chieko. Expression of Quaking RNA-Binding Protein in the Adult and Developing Mouse Retina. Plos One. 11(5):e0156033. PubMed |
| de Miguel, Fernando J; Pajares, María J; Martínez-Terroba, Elena; Ajona, Daniel; Morales, Xabier; Sharma, Ravi D; Pardo, Francisco J; Rouzaut, Ana; Rubio, Angel; Montuenga, Luis M; Pio, Ruben. A large-scale analysis of alternative splicing reveals a key role of QKI in lung cancer. Molecular Oncology. 2016;10(9):1437-1449. PubMed |
| Zhang, Keke; Yan, Fei; Lei, Xiaoying; Wei, Di; Lu, Huanyu; Zhu, Zheng; Xiang, An; Ye, Zichen; Wang, Li; Zheng, Wanxiang; Li, Xi'an; Yuan, Jiarui; Lu, Zifan; Yuan, Jianlin. Androgen receptor‑mediated upregulation of quaking affects androgen receptor‑related prostate cancer development and anti‑androgen receptor therapy. Molecular Medicine Reports. 2018;17(6):8203-8211. PubMed |
| Yang, Yueqin; Park, Juw Won; Bebee, Thomas W; Warzecha, Claude C; Guo, Yang; Shang, Xuequn; Xing, Yi; Carstens, Russ P. Determination of a Comprehensive Alternative Splicing Regulatory Network and Combinatorial Regulation by Key Factors during the Epithelial-to-Mesenchymal Transition. Molecular And Cellular Biology. 2016;36(11):1704-19. PubMed |
| Jacobs, Kathryn A; André-Grégoire, Gwennan; Maghe, Clément; Thys, An; Li, Ying; Harford-Wright, Elizabeth; Trillet, Kilian; Douanne, Tiphaine; Alves Nicolau, Carolina; Frénel, Jean-Sébastien; Bidère, Nicolas; Gavard, Julie. Paracaspase MALT1 regulates glioma cell survival by controlling endo-lysosome homeostasis. The Embo Journal. 2020;39(1):e102030. PubMed |
| Lu, Huanyu; Ye, Zichen; Zhai, Yue; Wang, Li; Liu, Ying; Wang, Jiye; Zhang, Wenbin; Luo, Wenjing; Lu, Zifan; Chen, Jingyuan. QKI regulates adipose tissue metabolism by acting as a brake on thermogenesis and promoting obesity. Embo Reports. 2020;21(1):e47929. PubMed |
| Stojanović, Stevan D; Fuchs, Maximilian; Liang, Chunguang; Schmidt, Kevin; Xiao, Ke; Just, Annette; Pfanne, Angelika; Pich, Andreas; Warnecke, Gregor; Braubach, Peter; Petzold, Christina; Jonigk, Danny; Distler, Jörg H W; Fiedler, Jan; Thum, Thomas; Kunz, Meik. Reconstruction of the miR-506-Quaking axis in Idiopathic Pulmonary Fibrosis using integrative multi-source bioinformatics. Scientific Reports. 2021;11(1):12456. PubMed |