Anti PYGB pAb (ATL-HPA031067 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031067-25

Protein Description: phosphorylase, glycogen; brain
Gene Name: PYGB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033059: 91%, ENSRNOG00000021090: 76%
Entrez Gene ID: 5834
Uniprot ID: P11216
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTMDGANVEMAEEAGAENLFIFGLRVEDVEALDRKGYNAREYYDHLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPP
• Gene Sequence: GTMDGANVEMAEEAGAENLFIFGLRVEDVEALDRKGYNAREYYDHLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPP
• Gene ID - Mouse: ENSMUSG00000033059
• Gene ID - Rat: ENSRNOG00000021090
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PYGB pAb (ATL-HPA031067 w/enhanced validation) – 5 Found

Zhu, Yuanyuan; Fan, Ze; Zhao, Qiuying; Li, Jiaqi; Cai, Guohong; Wang, Rui; Liang, Yi; Lu, Naining; Kang, Junjun; Luo, Danlei; Tao, Huiren; Li, Yan; Huang, Jing; Wu, Shengxi. Brain-Type Glycogen Phosphorylase Is Crucial for Astrocytic Glycogen Accumulation in Chronic Social Defeat Stress-Induced Depression in Mice. Frontiers In Molecular Neuroscience. 14( 35140588):819440. 

Jung, Minsun; Lee, Cheol; Han, Dohyun; Kim, Kwangsoo; Yang, Sunah; Nikas, Ilias P; Moon, Kyung Chul; Kim, Hyeyoon; Song, Min Ji; Kim, Bohyun; Lee, Hyebin; Ryu, Han Suk. Proteomic-Based Machine Learning Analysis Reveals PYGB as a Novel Immunohistochemical Biomarker to Distinguish Inverted Urothelial Papilloma From Low-Grade Papillary Urothelial Carcinoma With Inverted Growth. Frontiers In Oncology. 12( 35402263):841398. 

García-Consuegra, Inés; Asensio-Peña, Sara; Garrido-Moraga, Rocío; Pinós, Tomàs; Domínguez-González, Cristina; Santalla, Alfredo; Nogales-Gadea, Gisela; Serrano-Lorenzo, Pablo; Andreu, Antoni L; Arenas, Joaquín; Zugaza, José L; Lucia, Alejandro; Martín, Miguel A. Identification of Potential Muscle Biomarkers in McArdle Disease: Insights from Muscle Proteome Analysis. International Journal Of Molecular Sciences. 2022;23(9) 

Zois, Christos E; Hendriks, Anne M; Haider, Syed; Pires, Elisabete; Bridges, Esther; Kalamida, Dimitra; Voukantsis, Dimitrios; Lagerholm, B Christoffer; Fehrmann, Rudolf S N; den Dunnen, Wilfred F A; Tarasov, Andrei I; Baba, Otto; Morris, John; Buffa, Francesca M; McCullagh, James S O; Jalving, Mathilde; Harris, Adrian L. Liver glycogen phosphorylase is upregulated in glioblastoma and provides a metabolic vulnerability to high dose radiation. Cell Death & Disease. 2022;13(6):573. 

Fan, Ze; Zhang, Zhihao; Zhao, Shiyi; Zhu, Yuanyuan; Guo, Dong; Yang, Bo; Zhuo, Lixia; Han, Jiao; Wang, Rui; Fang, Zongping; Dong, Hailong; Li, Yan; Xiong, Lize. Dynamic Variations in Brain Glycogen are Involved in Modulating Isoflurane Anesthesia in Mice. Neuroscience Bulletin. 2020;36(12):1513-1523.