Anti PXN pAb (ATL-HPA051309)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051309-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: PXN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029528: 83%, ENSRNOG00000001149: 84%
Entrez Gene ID: 5829
Uniprot ID: P49023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALNGTILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSL |
| Gene Sequence | ALNGTILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSL |
| Gene ID - Mouse | ENSMUSG00000029528 |
| Gene ID - Rat | ENSRNOG00000001149 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PXN pAb (ATL-HPA051309) | |
| Datasheet | Anti PXN pAb (ATL-HPA051309) Datasheet (External Link) |
| Vendor Page | Anti PXN pAb (ATL-HPA051309) at Atlas Antibodies |
| Documents & Links for Anti PXN pAb (ATL-HPA051309) | |
| Datasheet | Anti PXN pAb (ATL-HPA051309) Datasheet (External Link) |
| Vendor Page | Anti PXN pAb (ATL-HPA051309) |
| Citations for Anti PXN pAb (ATL-HPA051309) – 2 Found |
| Baaske, Julia; Mühlhäuser, Wignand W D; Yousefi, O Sascha; Zanner, Sebastian; Radziwill, Gerald; Hörner, Maximilian; Schamel, Wolfgang W A; Weber, Wilfried. Optogenetic control of integrin-matrix interaction. Communications Biology. 2( 30652127):15. PubMed |
| Camillo, Chiara; Facchinello, Nicola; Villari, Giulia; Mana, Giulia; Gioelli, Noemi; Sandri, Chiara; Astone, Matteo; Tortarolo, Dora; Clapero, Fabiana; Gays, Dafne; Oberkersch, Roxana E; Arese, Marco; Tamagnone, Luca; Valdembri, Donatella; Santoro, Massimo M; Serini, Guido. LPHN2 inhibits vascular permeability by differential control of endothelial cell adhesion. The Journal Of Cell Biology. 2021;220(11) PubMed |