Anti PVALB pAb (ATL-HPA048536 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048536-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PVALB
Alternative Gene Name: D22S749
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005716: 88%, ENSRNOG00000006471: 94%
Entrez Gene ID: 5816
Uniprot ID: P20472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK |
Gene Sequence | ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK |
Gene ID - Mouse | ENSMUSG00000005716 |
Gene ID - Rat | ENSRNOG00000006471 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) | |
Datasheet | Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) | |
Datasheet | Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) |