Anti PVALB pAb (ATL-HPA048536 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA048536-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: parvalbumin
Gene Name: PVALB
Alternative Gene Name: D22S749
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005716: 88%, ENSRNOG00000006471: 94%
Entrez Gene ID: 5816
Uniprot ID: P20472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK
Gene Sequence ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK
Gene ID - Mouse ENSMUSG00000005716
Gene ID - Rat ENSRNOG00000006471
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PVALB pAb (ATL-HPA048536 w/enhanced validation)
Datasheet Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PVALB pAb (ATL-HPA048536 w/enhanced validation)
Datasheet Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PVALB pAb (ATL-HPA048536 w/enhanced validation)