Anti PUS7 pAb (ATL-HPA024116)

Atlas Antibodies

Catalog No.: ATL-HPA024116-25

Protein Description: pseudouridylate synthase 7 (putative)
Gene Name: PUS7
Alternative Gene Name: FLJ20485
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057541: 95%, ENSRNOG00000010572: 95%
Entrez Gene ID: 54517
Uniprot ID: Q96PZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGFDVIYPKHKIQEAYREMLTADNLDIDNMRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFNTDVDNLEGKTPPVFASEGKYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQ
• Gene Sequence: PGFDVIYPKHKIQEAYREMLTADNLDIDNMRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFNTDVDNLEGKTPPVFASEGKYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQ
• Gene ID - Mouse: ENSMUSG00000057541
• Gene ID - Rat: ENSRNOG00000010572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PUS7 pAb (ATL-HPA024116) – 1 Found

Ji, Xiong; Dadon, Daniel B; Abraham, Brian J; Lee, Tong Ihn; Jaenisch, Rudolf; Bradner, James E; Young, Richard A. Chromatin proteomic profiling reveals novel proteins associated with histone-marked genomic regions. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(12):3841-6.