Anti PURG pAb (ATL-HPA047746)

Atlas Antibodies

Catalog No.:
ATL-HPA047746-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: purine-rich element binding protein G
Gene Name: PURG
Alternative Gene Name: PURG-A, PURG-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049184: 90%, ENSRNOG00000015426: 92%
Entrez Gene ID: 29942
Uniprot ID: Q9UJV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
Gene Sequence RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
Gene ID - Mouse ENSMUSG00000049184
Gene ID - Rat ENSRNOG00000015426
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PURG pAb (ATL-HPA047746)
Datasheet Anti PURG pAb (ATL-HPA047746) Datasheet (External Link)
Vendor Page Anti PURG pAb (ATL-HPA047746) at Atlas Antibodies

Documents & Links for Anti PURG pAb (ATL-HPA047746)
Datasheet Anti PURG pAb (ATL-HPA047746) Datasheet (External Link)
Vendor Page Anti PURG pAb (ATL-HPA047746)