Anti PURG pAb (ATL-HPA047746)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047746-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PURG
Alternative Gene Name: PURG-A, PURG-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049184: 90%, ENSRNOG00000015426: 92%
Entrez Gene ID: 29942
Uniprot ID: Q9UJV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK |
Gene Sequence | RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK |
Gene ID - Mouse | ENSMUSG00000049184 |
Gene ID - Rat | ENSRNOG00000015426 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PURG pAb (ATL-HPA047746) | |
Datasheet | Anti PURG pAb (ATL-HPA047746) Datasheet (External Link) |
Vendor Page | Anti PURG pAb (ATL-HPA047746) at Atlas Antibodies |
Documents & Links for Anti PURG pAb (ATL-HPA047746) | |
Datasheet | Anti PURG pAb (ATL-HPA047746) Datasheet (External Link) |
Vendor Page | Anti PURG pAb (ATL-HPA047746) |